PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.353140.1
Common NameCsa_4G645830, LOC101213104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 370aa    MW: 42547.6 Da    PI: 6.3979
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.353140.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-092963312055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Cucsa.353140.1 296 YKWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 331
                     4679*****************************885 PP

2ELK37.93.8e-13251272122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYsgyL+sLkqE+s
  Cucsa.353140.1 251 ELKNHLLRKYSGYLSSLKQELS 272
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.8E-21107151IPR005540KNOX1
PfamPF037903.4E-21108150IPR005540KNOX1
SMARTSM012561.8E-28158209IPR005541KNOX2
PfamPF037911.2E-24163208IPR005541KNOX2
SMARTSM011881100167187IPR005539ELK domain
PROSITE profilePS5121311.296251271IPR005539ELK domain
SMARTSM011883.5E-7251272IPR005539ELK domain
PfamPF037892.6E-10251272IPR005539ELK domain
PROSITE profilePS5007113.038271334IPR001356Homeobox domain
SuperFamilySSF466894.28E-20272347IPR009057Homeodomain-like
SMARTSM003896.6E-13273338IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-27276337IPR009057Homeodomain-like
CDDcd000861.21E-11283335No hitNo description
PfamPF059201.4E-16291330IPR008422Homeobox KN domain
PROSITE patternPS000270309332IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MEEYNNDVNE NSNGRGNFLY GSGNSSSSNF GRSTAEMNVN NFHLQQGTDC FQSPHHQSIV  60
KTEATTSQHH HLLKFHYPLI RQQPPPPPPP QPQTSCRPEQ NGVVDFEAIK AKILAHPQYS  120
SLLEAYMECQ KVGAPPQVVE RLVAARQEFE ARQRSSMVSG ETIKDPELDQ FMEAYYDMLV  180
KYREELSRPI QEAMDFMRRI ESQLTSLCNG PVRIFNSDDK CDGMGSSEEE QENSGGETEL  240
PEIDPRAEDR ELKNHLLRKY SGYLSSLKQE LSKKKKKGKL PKEARQKLLN WWELHYKWPY  300
PSETEKVALA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF MVMDGLHPPN AALYIDGHYM  360
TDGHYRLGP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654162.10.0PREDICTED: homeobox protein knotted-1-like 2
SwissprotO041351e-178KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLA0A0A0L0L70.0A0A0A0L0L7_CUCSA; Uncharacterized protein
STRINGVIT_18s0001g08380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45843246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-131KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]